This is a working overview of hGH fragment, written for readers who want more than a one-paragraph summary but less than a textbook.
Reviewed 2025-08-30. Anything still debated is marked as such rather than presented as settled.
Several names appear in scientific and commercial settings. AOD9604 and AOD-9604 are development codes used interchangeably, while hGH fragment 176-191 describes the same region. The peptide includes a disulfide bond between two cysteine residues, which helps shape its three-dimensional structure. Different suppliers may provide acetate or other salt forms, and purity can vary. These differences matter because analytical tests and biological assays can respond to the specific form being studied.
Early interest in AOD-9604 centered on whether a fragment of human growth hormone could influence fat metabolism without the broader effects of the full hormone. Cell and animal studies reported changes in fat storage and breakdown. Human trials followed, but the results were not strong enough to secure regulatory approval. The compound remains available for laboratory research, and its clinical potential is still described as uncertain. Studies continue to examine its activity and safety profile.
AOD-9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to residues 176-191 of the 191-amino-acid hGH sequence. The fragment is not the full hormone and lacks the receptor-binding region associated with growth and metabolic effects of hGH. Researchers developed it to isolate a specific portion of hGH for study. Its exact sequence and length are often stated in peptide catalogs and patents.
The peptide is frequently described as a growth hormone fragment, although it is chemically distinct from full-length hGH. AOD-9604 contains 16 amino acids and includes two cysteine residues that can form an intramolecular disulfide bond. In solution, this structural feature can influence folding, aggregation, and stability. Published descriptions sometimes call it hGH 176-191 or AOD9604, with spacing and capitalization varying. Such naming differences can complicate literature searches, database entries, and product verification.
Researchers have studied the fragment in cell and animal models to understand its metabolic actions. Some experiments report effects on fat breakdown and fat storage pathways, but the underlying mechanism remains incompletely defined. AOD-9604 does not appear to stimulate the same broad growth hormone receptor signaling as full-length hGH. Whether its observed activities arise from direct receptor interactions or downstream metabolic changes is an open question. Results from different assays are not always consistent.
| Property | Value | Notes |
|---|---|---|
| Common name | AOD-9604 | Development code used in scientific literature. |
| Chemical class | Synthetic peptide | Fragment of human growth hormone. |
| Amino acid length | 16 residues | Matches hGH region 176-191. |
| Appearance | White to off-white powder | Typical lyophilized peptide solid. |
| Solubility | Soluble in water | Dissolves in aqueous media; exact behavior depends on salt form. |
Laboratory studies have reported that AOD9604 can increase lipolysis and reduce lipid accumulation in fat cells. The precise molecular target remains uncertain, and the compound does not appear to activate the growth hormone receptor in the same way as full-length hGH. Proposed mechanisms include effects on beta-adrenergic signaling and enzymes involved in fatty acid synthesis, but these pathways are not firmly established. Because most evidence comes from cell and animal models, whether the same effects occur in humans is an open question.
Clinical development of AOD9604 included trials in people with obesity, but the results did not lead to approval as a prescription medicine in major markets. Interest later shifted to research settings and to unapproved products marketed for body composition. Regulatory agencies have questioned whether the peptide qualifies as a dietary ingredient, and some have issued warnings about its presence in supplements. Long-term human safety data are limited, and questions about efficacy, dosing, and target populations remain unresolved.
AOD9604 is a synthetic peptide modeled on the C-terminal region of human growth hormone. It corresponds to a short sequence near the end of the 191-amino-acid hormone, often described as residues 176–191 or a related fragment. Researchers designed it to separate metabolic effects from the growth-promoting actions of full-length growth hormone. Early work in the 1990s explored it as a candidate for weight and lipid disorders. It is not a naturally circulating hormone fragment produced in large amounts.
Regulatory status: AOD-9604 is not approved as a therapeutic drug in the United States, European Union, or other major markets. It is listed by the World Anti-Doping Agency as a prohibited substance in sport, specifically under growth hormone fragments. Many jurisdictions restrict its sale for human consumption. Products marketed online may not meet pharmaceutical quality standards. The legal status varies by country and often depends on whether the material is presented as a research chemical, supplement, or drug.
Detection and characterization of AOD-9604 in research and anti-doping settings typically rely on mass spectrometry coupled with liquid chromatography. These methods can identify the peptide by its mass and fragmentation pattern. Immunoassays may also be used in some screening contexts, but they can cross-react with related peptides. Because the molecule is small and may be present at low concentrations, sample preparation and method validation are important. Confirmatory analysis usually requires comparison with a certified reference standard.
In laboratory settings, AOD-9604 is commonly supplied as a lyophilized powder and stored cold to limit degradation. Reconstituted solutions are typically kept refrigerated or frozen, depending on the buffer and concentration, and protected from repeated freeze-thaw cycles. Stability can be influenced by pH, temperature, and the presence of proteases. Purity is usually assessed by high-performance liquid chromatography and mass spectrometry. These practices support reproducibility, but they do not imply safety or efficacy for any human use.
An ion-exchange membrane is a semi-permeable membrane that transports certain dissolved ions, while blocking other ions or neutral molecules. Ion-exchange membranes are therefore electrically conductive. They are often used in desalination and chemical recovery applications, moving ions from one solution to another with little passage of water. Important examples of ion-exchange membranes include the proton-exchange membranes, that transport H+ cations, and the anion exchange membranes used in certain alkaline fuel cells to transport OH− anions.
Bruce Glick grew up in Pittsburgh, Pennsylvania and was interested in birds as a child. His father, Peter Glick, was the Secretary of Labor for Pennsylvania. Glick served in World War II. He went to Rutgers University and studied birds majoring in poultry science, graduating in 1951. In 1950 he married Kay McCall. He received an M.S. degree from the University of Massachusetts in genetics in 1952 and attended Ohio State University as a Ph.D. student, graduating with a PhD in physiology in 1955. While there, he worked on determining the purpose of the Bursa of Fabricius, a gland that he was able to remove from a goose without any apparent effect. A fellow graduate student, Timothy Chang, worked with Glick's geese in a different study, and noticed that the birds without the Bursa of Fabricius did not produce expected antibodies. Glick and Chang wrote up the results of this study and were unable to get it published in Science, so it was published in Poultry Science in 1956. Their publication, considered a landmark paper, is one of the most cited works from Poultry Science.
Both up and downregulation of miR-324-5p is shown to contribute to various types of cancer. miR-324-5p plays a role in inflammation and tumorigenesis in colorectal cancer through regulation of CUEDC2, which regulates inflammation via interaction with NF-kB signaling. miR-324-5p can inhibit glioma proliferation, suppress hepatocellular carcinoma and nasopharyngeal carcinoma cell invasion, and regulate growth and pathology in multiple myeloma. Additionally, chromosome 17 deletions, which include deletion of miR-324-5p, are present in 10% of multiple myeloma patients and are associated with poorer prognosis. In contrast, overexpression of miR-324-5p in gastric cancer cells reduces cell death and promotes growth and proliferation. miR-324-5p has also been shown to reduce the viability of gastric cancer cells via downregulation of TSPAN8, and miR-324-5p expression increased apoptosis in these same gastric cancer cells.
Sources: en.wikipedia.org
ProIAPP consists of 67 amino acids, which follow a 22 amino acid signal peptide which is rapidly cleaved after translation of the 89 amino acid coding sequence. The human sequence (from N-terminus to C-terminus) is: (MGILKLQVFLIVLSVALNHLKA) TPIESHQVEKR^ KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYG^ KR^ NAVEVLKREPLNYLPL. The signal peptide is removed during translation of the protein and transport into the endoplasmic reticulum. Once inside the endoplasmic reticulum, a disulfide bond is formed between cysteine residues numbers 2 and 7. Later in the secretory pathway, the precursor undergoes additional proteolysis and posttranslational modification (indicated by ^). 11 amino acids are removed from the N-terminus by the enzyme proprotein convertase 2 (PC2) while 16 are removed from the C-terminus of the proIAPP molecule by proprotein convertase 1/3 (PC1/3). At the C-terminus Carboxypeptidase E then removes the terminal lysine and arginine residues. The terminal glycine amino acid that results from this cleavage allows the enzyme peptidylglycine alpha-amidating monooxygenase (PAM) to convert the terminal glycine to an amine group (releasing glycolate). After this step, the transformation from the precursor protein proIAPP to the biologically active IAPP (amylin) is complete (IAPP sequence: KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2).
Acids play important roles in the human body. The hydrochloric acid present in the stomach aids digestion by breaking down large and complex food molecules. Amino acids are required for synthesis of proteins required for growth and repair of body tissues. Fatty acids are also required for growth and repair of body tissues. Nucleic acids are important for the manufacturing of DNA and RNA and transmitting of traits to offspring through genes. Carbonic acid is important for maintenance of pH equilibrium in the body. Human bodies contain a variety of organic and inorganic compounds, among those dicarboxylic acids play an essential role in many biological behaviors. Many of those acids are amino acids, which mainly serve as materials for the synthesis of proteins. Other weak acids serve as buffers with their conjugate bases to keep the body's pH from undergoing large scale changes that would be harmful to cells. The rest of the dicarboxylic acids also participate in the synthesis of various biologically important compounds in human bodies.
Chromosome 11 open reading frame 91, or C11orf91 is a protein which in humans is encoded by the C11orf91 gene. The C11orf91 gene consists of 5159 nucleotides with an mRNA of approximately 836 base pairs. There is one exon found in the C11orf91 gene. The cytogenetic band location of C11orf91 is 11p13 and is located on the minus strand of the DNA . Annotated depiction of the C11orf91 mRNA and amino acid protein sequences. The C11orf91 gene encodes a protein that is 193 amino acids in length. The C11orf91 protein contains a domain of unknown function, DUF5529, that spans nearly the entire protein. RBMX protein binding sites were found to be highly conserved in several structures of human C11orf91 3'UTR and 5' UTR. C11orf91 is rich in serine and proline and poor in valine and asparagine. There is a proline rich region found in the middle of the C11orf91. The human C11orf91 protein is approximately 20 kDal and has an isoelectric point around 9. Human C11orf91 protein is predicted to be localized in vesicles. C11orf91 has two helices located near the C-terminus and no beta sheets.
The main function of motilin is to increase the migrating myoelectric complex component of gastrointestinal motility and stimulate the production of pepsin. Motilin is also called "housekeeper of the gut" because it improves peristalsis in the small intestine and clears out the gut to prepare for the next meal. A high level of motilin secreted between meals into the blood stimulates the contraction of the fundus and antrum and accelerates gastric emptying. It then contracts the gallbladder and increases the squeeze pressure of the lower esophageal sphincter. Other functions of motilin include increasing the release of pancreatic polypeptide and somatostatin.
Sources: en.wikipedia.org
On 1 December 1978, the Health and Safety Executive announced their intention to prosecute the university for breach of safety legislation. The case was heard in October 1979 at Birmingham Magistrates' Court. Although the source of infection was traced, the mode and cause of transmission was not. Evidence presented by several internationally recognised experts, including Kevin McCarthy, Allan Watt Downie and Keith R. Dumbell, showed that airborne transmission from the laboratory to the telephone room where Parker was supposedly infected was highly improbable. The experts calculated that it would require 53,700 litres (11,812 imp gal) of virus fluid to have been aspirated (meaning, in this context, removed by suction of fluid and cells through a needle) and it would take 20,000 years for one particle to travel to the telephone room at the rate the fluid was aspirated. It was additionally found that although the Shooter Inquiry noted the poor state of the duct sealing in the laboratory, this was caused after the outbreak by engineers fumigating the laboratory and ducts. The university was found not guilty of causing Parker's death.
A transcriptor is a transistor-like device composed of DNA and RNA rather than a semiconducting material such as silicon. Prior to its invention in 2013, the transcriptor was considered an important component to build biological computers. To function, a modern computer needs three different capabilities: It must be able to store information, transmit information between components, and possess a basic system of logic. Prior to March 2013, scientists had successfully demonstrated the ability to store and transmit data using biological components made of proteins and DNA. Simple two-terminal logic gates had been demonstrated, but required multiple layers of inputs and thus were impractical due to scaling difficulties.
ADAM17 has been shown to interact with: DLG1 MAD2L1, and MAPK1. iRhom2. Adam17 may facilitate entry of the SARS‑CoV‑2 virus, possibly by enabling fusion of virus particles with the cytoplasmic membrane. Adam17 has similar ACE2 cleavage activity as TMPRSS2, but by forming soluble ACE2, Adam17 may actually have the protective effect of blocking circulating SARS‑CoV‑2 virus particles. Adam17 sheddase activity may contribute to COVID-19 inflammation by cleavage of TNF-α and Interleukin-6 receptor. Recently, ADAM17 was discovered as a crucial mediator of resistance to radiotherapy. Radiotherapy can induce a dose-dependent increase of furin-mediated cleavage of the ADAM17 proform to active ADAM17, which results in enhanced ADAM17 activity in vitro and in vivo. It was also shown that radiotherapy activates ADAM17 in non-small cell lung cancer, which results in shedding of multiple survival factors, growth factor pathway activation, and radiotherapy-induced treatment resistance.
Sources: en.wikipedia.org
AOD-9604 is a synthetic peptide fragment of human growth hormone. It corresponds to the C-terminal region known as hGH 176-191 and is studied for metabolic effects. It is not an approved therapeutic drug.
No. It contains only a small portion of the human growth hormone sequence. The full hormone has 191 amino acids and many additional actions that the fragment does not share.
The name refers to the amino acid positions in the human growth hormone chain. The fragment spans residues 176 through 191 at the C-terminal end. This naming convention helps distinguish it from full-length hGH.
No, it is a synthetic peptide fragment corresponding to a small portion of hGH. It is not the full 191-amino-acid hormone and does not reproduce all of hGH's effects.